DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and F9

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:261 Identity:83/261 - (31%)
Similarity:124/261 - (47%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHV---CGGAVISQRVVCSAAHCYAINTSVPLVY 98
            ::|||......|:|:||.:.           |.:   ||||:|:::.:.:||||......:.   
Mouse   236 RVVGGENAKPGQIPWQVILN-----------GEIEAFCGGAIINEKWIVTAAHCLKPGDKIE--- 286

  Fly    99 RDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNG--STLENDIAL------LFLNGFIPWE 155
                   ||||...||:.:...|...|.|.:.|..||.  :...:||||      |.||.::   
Mouse   287 -------VVAGEYNIDKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYV--- 341

  Fly   156 SPGVRAIPLAIKAPEEGTTCL-------IHGWGKVTMKEKSAS-LQQAPVPILNKELC--QVIYK 210
                  .|:.: |..|.|...       :.|||||..|.:.|| ||...||::::..|  ...:.
Mouse   342 ------TPICV-ANREYTNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFT 399

  Fly   211 LPASQMCAGFLQGGIDACQGDSGGPLICD----GRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :..:..|||:.:||.|:|:||||||.:.:    ..|.||||||..||..|..|:||.||.::.||
Mouse   400 IYNNMFCAGYREGGKDSCEGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWI 464

  Fly   272 R 272
            :
Mouse   465 K 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/258 (31%)
Tryp_SPc 38..273 CDD:238113 83/260 (32%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 81/258 (31%)
Tryp_SPc 237..467 CDD:238113 83/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.