DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:268 Identity:77/268 - (28%)
Similarity:121/268 - (45%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTATASPFVILPKIVGGYTVTIDQVPFQVSVR---RRSIHERHYGLGHVCGGAVISQRVVCSAAH 86
            |...|....|.|.|:.|....:.:.|:|||::   ......||:     |.|::|:||.:.:|||
Mosquito    10 PALIALGHSIRPPIIEGTEANLHEFPYQVSLQWNFNNGSRARHF-----CSGSIINQRWILTAAH 69

  Fly    87 CYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGF 151
            |..       .|.....:.||||.:.|...:...|...|.|...|:.|:.|.:..||.:|.|:. 
Mosquito    70 CLE-------EYTKDGWFEVVAGVNNIAHEEAGAQRRNVTRYEQHESYDLSAIRYDIGVLQLSH- 126

  Fly   152 IPWE-SPGVRAIPLAIKAPEEGTTCLIH-------GWGKVTMKEKSA---SLQQAPVPILNKELC 205
             |.: :..::.:.||.|      ..|||       |||.::...:..   .|.:..:.:..:|.|
Mosquito   127 -PLDLTRNIKTMRLATK------DTLIHQKIAKFAGWGSISKTWEDIYPDKLMKVNLILRTEEDC 184

  Fly   206 QVIYKLPASQMCAGFLQGGIDACQGDSGGPL--ICDGR--LAGIISWGVGCADPGYPGVYTNVSH 266
            |.|.|:..:|:|||..: .:..|..||||||  ..||.  ..|::|:|........|.||::|.:
Mosquito   185 QTIGKIDETQICAGGYK-NVSGCTADSGGPLTVTIDGEQMQIGVLSYGEKPCQARLPIVYSSVMY 248

  Fly   267 FLKWIRRA 274
            |..||:.|
Mosquito   249 FHDWIQDA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/251 (28%)
Tryp_SPc 38..273 CDD:238113 72/252 (29%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 72/252 (29%)
Tryp_SPc 23..253 CDD:214473 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.