DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001241

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_321913.5 Gene:AgaP_AGAP001241 / 1281929 VectorBaseID:AGAP001241 Length:267 Species:Anopheles gambiae


Alignment Length:289 Identity:89/289 - (30%)
Similarity:132/289 - (45%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGA 74
            :||....:...::.|..|:..|..  .:||||...||:.||:|||:|        |...|:|||:
Mosquito    17 VVARVHRLPAGRLLQVRASDDPRA--DRIVGGSKTTIESVPYQVSLR--------YFNNHICGGS 71

  Fly    75 VISQRVVCSAAHC---YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVG------ 130
            :||...|.:||||   |..|..:          .|..||::             |...|      
Mosquito    72 IISHSWVLTAAHCLDWYPHNDEI----------TVRTGSTS-------------QSAGGSLHAVF 113

  Fly   131 ----HKDYNGSTLENDIALLFLNGFIPWESP-----GVRAIPLAIKAP-EEGTTCLIHGWGKVTM 185
                |:.|:.:..:.|:|.:.:      .:|     |...||||.... ..|...|:.|||.:|.
Mosquito   114 YYHLHERYDPNEFQWDVATVRV------RTPMGLGAGRAPIPLATSTEWTVGERILVTGWGYLTA 172

  Fly   186 KEK-SASLQQAPVPILNKELCQVIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIIS 247
            ..| :.:||...:..:.:|.|...:.  :.|..:|||  ..|:|||.||||||.:.||...||:|
Mosquito   173 AGKVNDTLQMILLDAVPQESCNRTWTGFITADMLCAG--GPGVDACAGDSGGPAVQDGVQYGIVS 235

  Fly   248 WG-VGCADPGYPGVYTNVSH--FLKWIRR 273
            || :.|.: |.|||:||::|  ...:|||
Mosquito   236 WGSIDCGN-GLPGVFTNIAHPSVRSFIRR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/258 (31%)
Tryp_SPc 38..273 CDD:238113 82/259 (32%)
AgaP_AGAP001241XP_321913.5 Tryp_SPc 42..261 CDD:214473 81/258 (31%)
Tryp_SPc 43..264 CDD:238113 84/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.