DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001365

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_321778.5 Gene:AgaP_AGAP001365 / 1281817 VectorBaseID:AGAP001365 Length:608 Species:Anopheles gambiae


Alignment Length:275 Identity:81/275 - (29%)
Similarity:120/275 - (43%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCY 88
            :|..|.    |..:|:||.|....:.|:.|::   .:.|.:.     |||::|.:|.:.:||||.
Mosquito   354 EPVGTR----IRSRIIGGVTSNQGEHPWHVAI---YLDEEYQ-----CGGSIIGRRWILTAAHCL 406

  Fly    89 A-INTSVPLVYRDPELYVVVAG---SSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL- 148
            . .||:..|   |.:|:.|..|   .|.||  |.|.:  ....::.|:|||......||.||.| 
Mosquito   407 TRQNTNETL---DVDLFRVYTGIIDISTID--DHFYR--TADEVIVHRDYNPVMYTTDIGLLRLK 464

  Fly   149 -----NGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELC--- 205
                 |.||.......|.:.::.....||.   :.|||.......|..|....||::::::|   
Mosquito   465 RNITYNSFIKPVCLYNRTVDISTFYGREGK---VTGWGFNRDGVISNVLNYLEVPVVSQKMCSQR 526

  Fly   206 QVIYK---LPASQMCAGFLQGGIDACQGDSGGPLI-CDG---RLAGIISWGVG-----CADPGYP 258
            .|.:.   ......|||...|. ..|.|||||.|: .:|   .:.||:|....     ..||...
Mosquito   527 NVQFNGVLAVGESFCAGHADGN-SVCNGDSGGGLVFAEGPRYYVRGIVSISAQRRNLLLCDPNQY 590

  Fly   259 GVYTNVSHFLKWIRR 273
            .|:|:||.||.|||:
Mosquito   591 SVFTDVSKFLNWIRQ 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 75/258 (29%)
Tryp_SPc 38..273 CDD:238113 77/259 (30%)
AgaP_AGAP001365XP_321778.5 GD_N 42..144 CDD:292649
GD_N 190..297 CDD:292649
Tryp_SPc 363..603 CDD:214473 75/258 (29%)
Tryp_SPc 364..606 CDD:238113 78/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.