DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:261 Identity:90/261 - (34%)
Similarity:136/261 - (52%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||......|:.:..|:.:|.        ||.||.::::.|.:.:|.||  :.:.|..:.|..
Mosquito    11 RIVGGVNSNRGQITYIASLTKRG--------GHFCGASIVNDRWLLTAGHC--VCSGVNKILRAN 65

  Fly   102 ELYVVVA-------GSSAIDRTDRFTQ---EYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES 156
            ::..|:.       |.:.|| :|.|:.   |..::.||.|..|..:...||||||.|...|.: |
Mosquito    66 QIQAVLGLYRRSEFGGNQID-SDPFSDRAYEVGIRTIVPHPGYVCNKPSNDIALLELARRIDF-S 128

  Fly   157 PGVRAIPLAI----KAPEEGTTCLIHGWG----KVTMKEKSASLQQAPVPILNKELCQVIYK--- 210
            ..||.|.|:.    .|..||.|.::.|||    ...:.:|:.:||:|.|.:...|.|:.:|:   
Mosquito   129 ASVRPICLSSGADGSARVEGQTAVVAGWGWQQENRNLGDKADTLQRAVVDVFRNEECESMYRRGN 193

  Fly   211 ----LPASQMCAGFLQGGIDACQGDSGGPLI-CDGRLAGIISWGVGCADPGYPGVYTNVSHFLKW 270
                :..:|:|||...||:|||..||||||: .|..|.||:|.|:|||.||:||:||.||.:..|
Mosquito   194 RSRTIARTQLCAGKGTGGVDACWADSGGPLVTSDNVLIGIVSTGIGCARPGFPGIYTRVSEYASW 258

  Fly   271 I 271
            |
Mosquito   259 I 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/259 (34%)
Tryp_SPc 38..273 CDD:238113 90/260 (35%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 88/259 (34%)
Tryp_SPc 12..259 CDD:238113 88/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.