DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPD3

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_321698.4 Gene:CLIPD3 / 1281744 VectorBaseID:AGAP001433 Length:670 Species:Anopheles gambiae


Alignment Length:256 Identity:83/256 - (32%)
Similarity:119/256 - (46%) Gaps:34/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||......|.|:..::.........:.    |||::|..:.:.:||||...:...|...|. 
Mosquito   424 RIVGGIEAPTGQWPWMAAIFLHGTKRTEFW----CGGSLIGTKYILTAAHCTRDSRQRPFAARQ- 483

  Fly   102 ELYVVVAG--SSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVR---- 160
              :.|..|  ..:.|........|.|..:..|..::.....||||||.|      :.| ||    
Mosquito   484 --FTVRLGDIDLSTDGEPSAPVTYKVTEVRAHPRFSRVGFYNDIALLVL------DKP-VRKSKY 539

  Fly   161 AIPLAIKAPE-------EGTTCLIHGWGKVTMKEK-SASLQQAPVPILNKELCQVIYKLPASQ-- 215
            .||:.:..|.       .|....:.|||......| |...|||.:|:...|.|...|..|.:.  
Mosquito   540 VIPVCLPGPNLPSKERLAGRRATVVGWGTTYYGGKESTKQQQATLPVWRNEDCNRAYFQPITDNF 604

  Fly   216 MCAGFLQGGIDACQGDSGGPL--ICDGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            :||||.:||:|||||||||||  :.:.|  ..|::|:|..|.:||||||||.:|.:::|||
Mosquito   605 VCAGFSEGGVDACQGDSGGPLMMLVEARWTQVGVVSFGNKCGEPGYPGVYTRISEYMEWIR 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/253 (32%)
Tryp_SPc 38..273 CDD:238113 83/255 (33%)
CLIPD3XP_321698.4 CLIP 292..335 CDD:197829
Tryp_SPc 424..664 CDD:214473 80/253 (32%)
Tryp_SPc 425..667 CDD:238113 83/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.