DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001924

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_321140.5 Gene:AgaP_AGAP001924 / 1281201 VectorBaseID:AGAP001924 Length:381 Species:Anopheles gambiae


Alignment Length:261 Identity:61/261 - (23%)
Similarity:115/261 - (44%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAINTSVPLVYRDP 101
            |:||...|..:.|:..::..|:...:..    .|||.:|.:..:.:|||| |..:..:.|     
Mosquito    38 ILGGRNATAGKWPWHATLMHRAGDAKKL----ACGGNIIDKHTILTAAHCLYDRHKLIAL----- 93

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIP----------WES 156
            :..||:.|.:.:...:.:::.|..:|::.|..|..:.:::|||::.|...|.          |  
Mosquito    94 DRLVVILGRTELSVEEPWSRSYAPERLILHPGYKQANVKDDIAMVKLASEITMSDYIFPVCLW-- 156

  Fly   157 PGVRAIPLAIKAPE-EGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELC------QVIYKLPAS 214
                  |..:...: .|....:.|:|.......|..|....||::::..|      .:..:|.::
Mosquito   157 ------PRGLGHEDITGRKGFVVGYGLNDAGSTSNHLLDVEVPVVDRWTCLESNRDTLSSQLAST 215

  Fly   215 QMCAGFLQGGIDACQGDSGGPLIC----DGRLAGIISW-----GVGCADPGYPGVYTNVSHFLKW 270
            .:||| .:.|:..|.|||||.:..    :..:.||:|:     |....||....:||:|:.:|.|
Mosquito   216 MLCAG-ARDGVGPCNGDSGGGMFFMAGNEWHIRGIVSFAPNLDGTDKCDPKQYAIYTDVAKYLDW 279

  Fly   271 I 271
            |
Mosquito   280 I 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 59/259 (23%)
Tryp_SPc 38..273 CDD:238113 61/261 (23%)
AgaP_AGAP001924XP_321140.5 Tryp_SPc 38..283 CDD:238113 61/261 (23%)
Tryp_SPc 38..280 CDD:214473 59/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.