DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPA2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320727.4 Gene:CLIPA2 / 1280859 VectorBaseID:AGAP011790 Length:503 Species:Anopheles gambiae


Alignment Length:258 Identity:70/258 - (27%)
Similarity:116/258 - (44%) Gaps:52/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCY------AINTSVPLVYRDPELYVV 106
            :.|:.|::.:  :.|:.|    .|.||:|..:.:.:.|||.      |.|    ::.|..|..:.
Mosquito   248 EFPWMVALFQ--LPEQRY----CCNGALIDPKAILTTAHCVTNCGGRAAN----IMVRFGEWNMS 302

  Fly   107 VAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPL-----AI 166
            .....||.|.|     ..|:.:..|..|:.|.|.|:||:|.|...:.:::. ::.:.|     .:
Mosquito   303 STHEMAIPRED-----IGVKSVHQHPRYSPSALLNNIAVLELAHPVQYQAT-IQPVCLPSANQPL 361

  Fly   167 KAPEEGTTCLIHGWGKVTMKE--------KSASLQQAPVPILNKELCQV----IYKLPASQMCAG 219
            :|.|   ..:..|||:| |:|        |...||:....|..:.|.:|    .:.|.:|.:|:.
Mosquito   362 RAME---NMIATGWGRV-MEENAPPTQILKRLDLQRMEPSICREALRRVRRPYPFILDSSFVCST 422

  Fly   220 FLQGGID-ACQGDSGGPLICD-----GR--LAGIISWGVGCADPGYP-GVYTNVSHFLKWIRR 273
            ...|..: .|.||:|.|::.:     .|  |.|::|||.||.....| .|.|.|.||.:||.|
Mosquito   423 TNHGDQERPCDGDAGAPVVVELPGTTNRYYLHGLVSWGYGCHQKQIPYTVLTKVVHFREWIDR 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 67/254 (26%)
Tryp_SPc 38..273 CDD:238113 69/256 (27%)
CLIPA2XP_320727.4 Tryp_SPc 244..486 CDD:238113 70/258 (27%)
Tryp_SPc 244..483 CDD:214473 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.