DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:241 Identity:74/241 - (30%)
Similarity:114/241 - (47%) Gaps:32/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            ::|||::|...|:.:||||....|...|..|..| :...:........||     .|..|..|:.
Mosquito   193 YMCGGSLIHPSVILTAAHCVQNITITALKVRLGE-WDTRSWKEPFPHQDR-----RVVEIAFHEQ 251

  Fly   134 YNGSTLENDIALLFLNGFIP-WESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEK---SASLQQ 194
            :......|::|||||:..:. .|:.....:|.| ....:...|:..||||.....:   .|.|::
Mosquito   252 FFAPAALNNVALLFLDKPVELMETVNTICLPPA-NYTFDPVRCVASGWGKDVFGNEGMFQAILKK 315

  Fly   195 APVPILNKELCQVI---------YKLPASQMCAGFLQGGIDACQGDSGGPLIC------DGRL-A 243
            ..:|::.:..||..         :||..|.:|||. :.|.|.|:||.|.||:|      :|.. |
Mosquito   316 VELPLMPRGACQRALRMTRLGRRFKLHESFLCAGG-EKGRDTCKGDGGSPLVCPIPGVANGYYQA 379

  Fly   244 GIISWGVGCADPGYPGVYTNVSHFLKWI----RRANASLDYSEYRQ 285
            .|::||:.|...|.||||.||:.|.:||    |:.|.::||.:|.|
Mosquito   380 SIVAWGINCGIEGVPGVYVNVALFREWIDEQLRKRNLAIDYYQYGQ 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 66/221 (30%)
Tryp_SPc 38..273 CDD:238113 68/227 (30%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 68/224 (30%)
Tryp_SPc 167..407 CDD:214473 66/221 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.