DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:134 Identity:46/134 - (34%)
Similarity:70/134 - (52%) Gaps:24/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 CLIHGWGKVTMKEK---SASLQQAPVPILNKELCQVI---------YKLPASQMCAGFLQGGIDA 227
            |:..||||.....:   ...:::..:|::.:..||..         :||..|.:|||. :.|.|.
Mosquito    21 CVASGWGKDVFGNEGMLQVIMKKVELPLVPRGACQRALRTTHLGRQFKLHESFVCAGG-EKGRDT 84

  Fly   228 CQGDSGGPLIC------DGRL-AGIISWGVGCADPGYPGVYTNVSHFLKWI----RRANASLDYS 281
            |:||.|.||:|      :|.. |||::||:.|...|.||||.||:.|.:||    |:.|.::||.
Mosquito    85 CKGDGGSPLVCPIPGVANGYYQAGIVAWGIDCGKEGIPGVYVNVALFREWIDEQLRKRNLAIDYY 149

  Fly   282 EYRQ 285
            :|.|
Mosquito   150 QYGQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 38/114 (33%)
Tryp_SPc 38..273 CDD:238113 40/120 (33%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 40/117 (34%)
Tryp_SPc <2..135 CDD:214473 38/114 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.