DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP011910

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320619.4 Gene:AgaP_AGAP011910 / 1280754 VectorBaseID:AGAP011910 Length:408 Species:Anopheles gambiae


Alignment Length:254 Identity:70/254 - (27%)
Similarity:118/254 - (46%) Gaps:38/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPKIVGGYTVTIDQVPFQ---VSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPL 96
            |.:||.|....:::.|..   :.|:.:::         :||..:::.....:||||        |
Mosquito   163 LNRIVNGVETAVNEFPMMAALIDVKTKTV---------ICGATIVTNSYALTAAHC--------L 210

  Fly    97 VYRDPELYVVVAGSSAIDR-TD-RFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGV 159
            :.|.....|::.|...|.. || .|:|.|:|.:.:.|..:....:.|||||:.....|.: :|||
Mosquito   211 LQRTVNDTVLLVGDHNIKTGTDTSFSQVYIVAQFMSHPGFTVRPVANDIALVRTGRPIQY-NPGV 274

  Fly   160 --RAIPLAIKAPE-EGTTCLIHGWGKVTM-KEKSASLQQAPVPILNKELC--QVIYKLPASQMCA 218
              ..:|.:..... ||.|....|||.:.. ..::.:|.:..:.::..:.|  ::...:|..|:|.
Mosquito   275 GPACLPWSYTTQSFEGRTVEATGWGDLDFGGPRATALNKVQLAVIGNQECSQRLSASVPYQQLCT 339

  Fly   219 GFLQGGIDACQGDSGGPL----ICDGRL--AGIISWGVGCADPGYPGVYTNVSHFLKWI 271
              .....|.|||||||||    :.:|.|  .||:|:|:.||... |.|.|.|:.:|.||
Mosquito   340 --YTANRDTCQGDSGGPLFFTNLANGLLYDVGIVSFGIACATAN-PSVNTRVTEYLDWI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 67/250 (27%)
Tryp_SPc 38..273 CDD:238113 69/251 (27%)
AgaP_AGAP011910XP_320619.4 CUB 27..146 CDD:238001
Tryp_SPc 165..395 CDD:214473 67/250 (27%)
Tryp_SPc 166..396 CDD:238113 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.