DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP011912

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320615.4 Gene:AgaP_AGAP011912 / 1280750 VectorBaseID:AGAP011912 Length:408 Species:Anopheles gambiae


Alignment Length:263 Identity:72/263 - (27%)
Similarity:114/263 - (43%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQ---VSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCY---AINTSVP 95
            |||.|....:::.|..   |....||:         .||..:||.....:||||.   :::.| .
Mosquito   169 KIVNGVPTLVNEFPMMAGLVDSSSRSV---------FCGATIISDYHSITAAHCMRGRSLSAS-G 223

  Fly    96 LVYRDPELYVVVAGSSAIDRTDRFTQEYLVQR---IVGHKDYNGSTLENDIALLFLNGFIPWESP 157
            |:..|..|.|         .||  |...::.|   |..|..|..|...|||||:.....|.:.:.
Mosquito   224 LLVGDHNLSV---------GTD--TSYSVLMRLASITNHPQYVVSPSRNDIALVRTADRIAFNAA 277

  Fly   158 -GVRAIPLAIKAPE-EGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIYKLP---ASQM 216
             |...:|....... .|:.....|||.:.....::: |::..:.:::::.||  ..:|   ||.:
Mosquito   278 VGPACLPFRYSTSNFAGSIVEATGWGTMDFGAPTSNVLRKVSLNVISEQSCQ--SSMPNILASHI 340

  Fly   217 CAGFLQGGIDACQGDSGGPLI--CDGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            |.  ...|.|.||.||||||:  ..||  |.|::::||.||. ..|.|.:.::.:|.||:.....
Mosquito   341 CT--YTPGKDTCQYDSGGPLLFTTGGRVYLVGVVNYGVSCAS-SKPSVSSRITSYLSWIQSVTPG 402

  Fly   278 LDY 280
            :.|
Mosquito   403 VTY 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 69/252 (27%)
Tryp_SPc 38..273 CDD:238113 70/253 (28%)
AgaP_AGAP011912XP_320615.4 CUB 55..155 CDD:238001
Tryp_SPc 169..396 CDD:214473 69/252 (27%)
Tryp_SPc 170..399 CDD:238113 70/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.