DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPB16

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320055.4 Gene:CLIPB16 / 1280226 VectorBaseID:AGAP009263 Length:406 Species:Anopheles gambiae


Alignment Length:310 Identity:87/310 - (28%)
Similarity:126/310 - (40%) Gaps:93/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHY--GLG-------------------HVCGGA 74
            |.|..|::|...|....:.|   :...:||.:..:  |||                   ..|.|:
Mosquito   121 PHVCCPRVVTSPTFNDQRAP---AACGKSIVQGDFYNGLGAYPFVARIGFKNTKTGTFIFPCSGS 182

  Fly    75 VISQRVVCSAAHC-----------------YAINTSVPLVYRDPELYVVVAGSS------AIDRT 116
            :|::::|.::|||                 |...|       ||:     .||:      ||:  
Mosquito   183 IIARQIVLTSAHCALAKAESHRLSSVRVGDYDTRT-------DPD-----CGSTGFCAPVAIN-- 233

  Fly   117 DRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEE----GTTCLI 177
                  :.|.:|:.|.||......:|||||.|...|.:.   |.|.|:.:.|.::    |....|
Mosquito   234 ------HAVSQIIVHPDYIEGQYHHDIALLILRTPINYT---VAAQPICLHARKQDLTVGRRVQI 289

  Fly   178 HGWGKV-TMKEKSASLQQAPVPILNKELCQVIY----------KLPASQMCAGFLQGGIDACQGD 231
            .||||: |...||..||...||:.:.:.|...|          .:....||||  ..|.|||.|.
Mosquito   290 IGWGKLSTSAAKSPELQSLEVPLTSWDKCVRAYASTGALQSPQSIDGEWMCAG--GEGRDACHGF 352

  Fly   232 SGGPLIC--DGRLA--GIISWGV-GCADPGYPGVYTNVSHFLKWIRRANA 276
            .|.|||.  .||.|  ||:|:|. .|.....|.|||:::|:..|| .||:
Mosquito   353 GGAPLIIRDQGRYAQIGIMSFGAETCGALNMPSVYTSIAHYAPWI-EANS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/297 (27%)
Tryp_SPc 38..273 CDD:238113 82/298 (28%)
CLIPB16XP_320055.4 CLIP 88..126 CDD:295450 2/4 (50%)
Tryp_SPc 157..400 CDD:238113 75/268 (28%)
Tryp_SPc 157..397 CDD:214473 73/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.