DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP009252

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320033.4 Gene:AgaP_AGAP009252 / 1280210 VectorBaseID:AGAP009252 Length:460 Species:Anopheles gambiae


Alignment Length:287 Identity:56/287 - (19%)
Similarity:98/287 - (34%) Gaps:102/287 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IDQVPFQVSVRRRSIHERHYGLGHV---------------------CGGAVISQRVVCSAAHCYA 89
            :|:...::.....|.:|..:..|::                     |.|.:|:.:.|.::|.|..
Mosquito   221 LDECAHRIKASSGSTNEAQFETGYISEPYLVEVGWRGNGDAKAQWSCRGTLITSKAVLTSAKCLQ 285

  Fly    90 INTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPW 154
            ..:..|.|.|       :..:.|....:       |:..:.|.:::.::.:|:|||:.:...|..
Mosquito   286 QQSIAPSVIR-------LGLNEAAPVVN-------VEETILHPEFDVASGKNNIALIKMKDAIDQ 336

  Fly   155 ESPGVRAIPLAIKAPEEGTTCLIHGWGKVT----------MKEKSASLQQAPVPILNK------- 202
            .:       :||     ...||   |...|          :||.:.    .|.....|       
Mosquito   337 ST-------IAI-----NPACL---WKNQTHTPFEMIQPVIKESTL----GPALAFTKFNSDCDR 382

  Fly   203 ---------ELCQVIYKLPASQMCAGFLQGGIDACQGDSGG----PLICDGR----LAGIISWGV 250
                     |||..:.:||...             .|||||    .|:.:.:    :..:.|:|.
Mosquito   383 TFRRTLDEHELCVDVEQLPYMD-------------TGDSGGRLQVKLLHNAKVTPFVVAVTSFGS 434

  Fly   251 GCADPGYPGVYTNVSHFLKWIRRANAS 277
            .|.. ..|||||.||.:..|||...|:
Mosquito   435 ACGQ-STPGVYTKVSKYAPWIRSVIAA 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 52/279 (19%)
Tryp_SPc 38..273 CDD:238113 54/281 (19%)
AgaP_AGAP009252XP_320033.4 Tryp_SPc 248..457 CDD:304450 51/255 (20%)
Tryp_SPc 248..454 CDD:214473 48/252 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.