DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP009121

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_319873.4 Gene:AgaP_AGAP009121 / 1280073 VectorBaseID:AGAP009121 Length:269 Species:Anopheles gambiae


Alignment Length:286 Identity:88/286 - (30%)
Similarity:133/286 - (46%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATHSGIT-QSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69
            :||:.||..:..: |::.|.|:.         ::|||......:.|..||::|..:    ....|
Mosquito     8 LCLVAVAAAAPRSLQAKYGFPSG---------RVVGGIDALPGEFPSIVSIQRVIL----VVSTH 59

  Fly    70 VCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDY 134
            :|||:::|...|.:||||...|.:.       ..:.:.||:.....|:...|...|.....|.||
Mosquito    60 ICGGSILSNFWVLTAAHCITENPAT-------ANFAIWAGTHNTAITEDTRQVISVASSTVHPDY 117

  Fly   135 NGSTLENDIALLFLNG---FIPWESPGVRAIPLAIKAPEEGTT----CLIHGWGKV--TMKEKSA 190
            .|.....|||::.|..   |.|      |..|:.:.||  |:|    ..:.|||..  |:.....
Mosquito   118 QGGVNPTDIAVMRLAAPLTFTP------RIQPVVLPAP--GSTPSGPATLAGWGSTGGTLPTLPN 174

  Fly   191 SLQQAPVPILNKELCQ----VIYKLPASQMCAGFLQGGIDACQGDSGGPL--ICDGR--LAGIIS 247
            .||:...||:..|.|:    |...|..:.:|.|.|.||:.||.|||||||  :.:|:  ..||:|
Mosquito   175 ILQKVTKPIIPFEECRSAAGVDAPLGPTNVCTGPLTGGVSACSGDSGGPLYTVQNGQQVQVGIVS 239

  Fly   248 WG-VGCADPGYPGVYTNVSHFLKWIR 272
            || :.|...|:|.||..|||::.||:
Mosquito   240 WGWIPCGTIGFPSVYVGVSHYIDWIQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/251 (31%)
Tryp_SPc 38..273 CDD:238113 81/253 (32%)
AgaP_AGAP009121XP_319873.4 Tryp_SPc 31..264 CDD:214473 79/251 (31%)
Tryp_SPc 32..267 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.