DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and TRY5_ANOGA

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_317174.2 Gene:TRY5_ANOGA / 1277691 VectorBaseID:AGAP008291 Length:274 Species:Anopheles gambiae


Alignment Length:282 Identity:96/282 - (34%)
Similarity:141/282 - (50%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQIGQPT---ATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69
            ||..|......:.::.:|.   |...|::...:||||:.:.|...|:|:|::        |...|
Mosquito    15 LLAYARAQAERRHKLTRPVHRFAPNRPYLAGKRIVGGFVINISDAPYQISLQ--------YDDDH 71

  Fly    70 VCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSS------AIDRTDRFTQEYLVQRI 128
            .|||:::|.:.:.:||||  ||.:.|   ..|.:.|   |||      .:.|         |.||
Mosquito    72 NCGGSILSSKWILTAAHC--INDNAP---SKPTVRV---GSSKHASGGTVIR---------VARI 119

  Fly   129 VGHKDYNGSTLENDIALLFLNGFIPW-ESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS- 191
            |.| ..:||....|||||.|...:.: |.....|:|...:..||||..::.||| :|:.|..:: 
Mosquito   120 VPH-PMHGSKNNYDIALLELKNELTFSEKVQPIALPEQDEPIEEGTMGIVSGWG-LTLSEADSND 182

  Fly   192 -LQQAPVPILNKELCQVIYK-----LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGV 250
             |:...||.:|::.|...|:     :.....|||:.|||.|.|:.|||||.:..|:|.|:||||.
Mosquito   183 VLRATNVPTVNQQECNKAYQSRYGGITDQMFCAGYKQGGQDTCRQDSGGPFVAKGKLIGVISWGH 247

  Fly   251 GCADPGYPGVYTNVSHFLKWIR 272
            .||..||||||..|:....|||
Mosquito   248 ECALAGYPGVYARVASVRDWIR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/247 (35%)
Tryp_SPc 38..273 CDD:238113 90/249 (36%)
TRY5_ANOGAXP_317174.2 Tryp_SPc 47..268 CDD:214473 87/247 (35%)
Tryp_SPc 48..271 CDD:238113 90/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.