DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP006672

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_316708.4 Gene:AgaP_AGAP006672 / 1277262 VectorBaseID:AGAP006672 Length:327 Species:Anopheles gambiae


Alignment Length:332 Identity:94/332 - (28%)
Similarity:140/332 - (42%) Gaps:87/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHS------------------GITQSQIGQP------------TATASPFVI---- 34
            |.:|:::.||..                  .:.|:..|.|            ||...|.:|    
Mosquito    11 LLLCVVLCATDGEASPTYRRSKPPKMGMFWTVIQNVSGPPVPPSASILSAASTALYRPKLIIDRA 75

  Fly    35 -LPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAINTSVPLV 97
             |.|:.||.....||.|..||:    |.....|...:|||::::.|.:.:|||| |.:..:    
Mosquito    76 SLSKVAGGTVAKNDQFPHLVSI----ILIFADGSDTLCGGSILADRFILTAAHCLYGMQEA---- 132

  Fly    98 YRDPELYVVVAGSSAID---RTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGV 159
                   .:|.|.|.|.   ..|..|........:.|..|:...:.|||||:.|...:.:.:   
Mosquito   133 -------TIVPGQSVIQIPFPPDIVTVAIKPADTILHPGYDPVDILNDIALIRLPQPLTFSA--- 187

  Fly   160 RAIPLAIKAPE--------EGTTCLIHGWGKVT-------MKEKSASLQQAPVPILNKELCQVIY 209
            |..|  |:.|.        .|...::.|||..:       :.|....|:.|...|:...:|..:|
Mosquito   188 RVQP--IRLPSWTNSYVDLTGYDSIVSGWGAQSNDDYAELVDEMRLDLRFATNTIVPNAVCHRVY 250

  Fly   210 K--LPASQMC-AGFLQGGIDACQGDSGGPLIC--DG-RL--AGIISWG--VGCADPGYPGVYTNV 264
            .  :...|:| ||  :||.:.|||||||||..  || ||  .||:|:|  :|| :.|.|||||.|
Mosquito   251 GSIIRDQQICVAG--EGGRNPCQGDSGGPLTVKFDGQRLTQVGIVSYGSVLGC-ENGVPGVYTRV 312

  Fly   265 SHFLKWI 271
            |.:::||
Mosquito   313 SSYVEWI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/262 (31%)
Tryp_SPc 38..273 CDD:238113 81/263 (31%)
AgaP_AGAP006672XP_316708.4 Tryp_SPc 79..319 CDD:214473 80/262 (31%)
Tryp_SPc 80..319 CDD:238113 79/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.