DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP006539

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_316577.4 Gene:AgaP_AGAP006539 / 1277138 VectorBaseID:AGAP006539 Length:270 Species:Anopheles gambiae


Alignment Length:251 Identity:84/251 - (33%)
Similarity:123/251 - (49%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||.|...:|...||.:|:|..:      | ||.|||:::|:....:||||.:..|:.       
Mosquito    35 RIVNGTDASILDYPFMLSLRGST------G-GHSCGGSILSELWAMTAAHCVSSTTTY------- 85

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLE-NDIALLFLNGFIPWESPGVRAIPLA 165
             |..:..|.:.|.| |.....|.:.:::.|..|:..... ||||||.|...|.: |..|:  |:.
Mosquito    86 -LQTIQVGRTNISR-DVDDSVYGIAQVIAHPQYDSRNSHLNDIALLKLQRPIVF-SESVQ--PVR 145

  Fly   166 IKAP---------EEGTTCLIHGWGKV-TMKEKSASLQQAPVPILNKELCQVIY--KLPASQMCA 218
            :.||         :.|.|.:  |||.: |.....|:||:....::..|.|..|:  .:..|.:||
Mosquito   146 LPAPMFEVEDDLDDLGVTLI--GWGLLATGGSAPATLQRVDYYVVPNEECNAIHTGTIYPSHICA 208

  Fly   219 GFLQGGIDACQGDSGGPLICDGRLAGIISWGV-GCADPGYPGVYTNVSHFLKWIRR 273
            ....||...|.|||||||:..|...||:||.| .||...||||.|.|||.|::|::
Mosquito   209 AIPGGGKGQCSGDSGGPLLHHGVQVGIVSWSVKPCAVAPYPGVLTKVSHHLEFIQQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/247 (34%)
Tryp_SPc 38..273 CDD:238113 84/248 (34%)
AgaP_AGAP006539XP_316577.4 Tryp_SPc 35..262 CDD:214473 83/247 (34%)
Tryp_SPc 36..265 CDD:238113 84/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.