DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and SP24D_ANOGA

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_316450.1 Gene:SP24D_ANOGA / 1277027 VectorBaseID:AGAP006416 Length:271 Species:Anopheles gambiae


Alignment Length:255 Identity:81/255 - (31%)
Similarity:112/255 - (43%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC-YAINTSV 94
            ||....:||||...:..|.|.||::.|        |....|||::|..|.|.:|||| |.....|
Mosquito    43 PFFQGARIVGGSVASEGQFPHQVALLR--------GNALTCGGSLIESRWVLTAAHCVYNGALVV 99

  Fly    95 PLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGV 159
            |     ....||||||.::....|    ..|.|::.|:.|  ...:||:|||.|...:| .|..:
Mosquito   100 P-----ASSIVVVAGSVSLSNGVR----RAVARVIPHERY--GNFKNDVALLQLQLSLP-SSAYI 152

  Fly   160 RAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVP-ILNKELCQVIYKLPASQMC---AGF 220
            |.|.|...:...|:..:|.|||::        .|..||. :|......|:    |.|.|   .|.
Mosquito   153 RPIALRTTSVPAGSEVVISGWGRM--------YQGGPVSNMLRYNRATVV----ADQQCRMATGI 205

  Fly   221 LQGGI--------DACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            ..|.|        .||.||||||.|.:.:|.|:.::.:.......|..|..||.|:.||:
Mosquito   206 STGLICFTSPVNNGACNGDSGGPAILNNQLVGVANFIINYCGSASPDGYARVSDFVTWIQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/246 (31%)
Tryp_SPc 38..273 CDD:238113 79/248 (32%)
SP24D_ANOGAXP_316450.1 Tryp_SPc 49..264 CDD:214473 77/246 (31%)
Tryp_SPc 50..267 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.