DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:289 Identity:81/289 - (28%)
Similarity:121/289 - (41%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATH----SGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            |::|..|    ||.|.:....|.|.         |:||..|...:.|:..            ||.
Mosquito    10 LVLVLGHREEVSGATIADRLSPMAL---------IIGGTDVEDGKAPYLA------------GLV 53

  Fly    69 H-----VCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFT--QEYLVQ 126
            :     .|||::|:.|.:.:|||| ..|.:|      ..|.||..|::     |.:.  ..|.:.
Mosquito    54 YNNSATYCGGSIIAARWILTAAHC-VTNVNV------TNLTVVRVGTN-----DNYEGGSMYQID 106

  Fly   127 RIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTM-KEKSA 190
            |::.|:.|:..|..||:|||.|...|.:|. .|..|.|..:......|..|.|||.|.. ||...
Mosquito   107 RVIPHERYSAITFRNDVALLRLKTPIKFEE-HVEKIELNEELVPINATLTIVGWGFVGWNKENPK 170

  Fly   191 SLQQAPVPILNKELCQ------VIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG 249
            ..|...|..:....|:      .||   ...:|. |.:.|...|:||||.|::..|:..|::||.
Mosquito   171 RTQVIKVQHIGLNRCRKMANGSAIY---PEHLCT-FSRAGHGPCKGDSGSPVVWKGKQVGVVSWA 231

  Fly   250 V-GCADPGYPGVYTNVSHFLKWIRRANAS 277
            : |....|.|.|..::.:|..||.:..|:
Mosquito   232 MAGVCAIGLPDVQASIRYFYGWITKTMAA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/248 (28%)
Tryp_SPc 38..273 CDD:238113 72/249 (29%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 72/250 (29%)
Tryp_SPc 35..254 CDD:214473 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.