DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:279 Identity:78/279 - (27%)
Similarity:123/279 - (44%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCG 72
            |:::..||           ..|||...|..|:||..|...:||:.||:...|.         |||
Mosquito     9 LVLLVVHS-----------LEASPVEPLAPIIGGSNVEDKKVPYLVSITVNSF---------VCG 53

  Fly    73 GAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQE---YLVQRIVGHKDY 134
            |::|:.|.:.:||||...|              :|..::....|:.||..   |.:.|.:.|:.|
Mosquito    54 GSIIADRWILTAAHCVKRN--------------MVKNAAVRVETNNFTASGTLYRIDRAIAHEKY 104

  Fly   135 NGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASL-QQAPVP 198
            ......:|:.||.|...:.: ...|:.|.|..:......|..:.|.|.::...|:..: |.....
Mosquito   105 FRGAFRDDVGLLRLRSPLKF-GERVKKIELLSQIVPYNATLTLVGRGYISKDNKTTKITQMIKAK 168

  Fly   199 ILNKELCQ-----VIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYP 258
            .:..:||:     .||   ...:|. |::.|...|.||||||::..||..||:||..||. .||.
Mosquito   169 NIALKLCRKMQPDFIY---PGHLCT-FVKKGKGTCSGDSGGPVVWYGRQVGIVSWSKGCG-AGYF 228

  Fly   259 GVYTNVSHFLKWIRRANAS 277
            .|::.:|:||.||:...|:
Mosquito   229 DVHSRISYFLPWIKATIAA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 68/242 (28%)
Tryp_SPc 38..273 CDD:238113 70/243 (29%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 70/244 (29%)
Tryp_SPc 28..241 CDD:214473 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.