DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:268 Identity:77/268 - (28%)
Similarity:120/268 - (44%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINT--SVPLVYRDPELYVVVAGS 110
            :.|:.|.:......|.:.| ..||||.:|..|:|.:.||    ||  ...||.|        .|.
Mosquito     7 EYPWVVYILALKKQEANSG-DFVCGGTLIHSRLVVTTAH----NTDGKTDLVAR--------FGE 58

  Fly   111 SAIDRT-DRFTQEYL-------VQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIK 167
            ..|..| :.|.|:.|       |..::.|..|..:.::||||||.|...:.: :..:|  |:.:.
Mosquito    59 WDISTTKEPFPQQCLFPHQDIDVAEVIKHPQYVFNPIQNDIALLVLAENVQY-AAHIR--PICLP 120

  Fly   168 APEE---GTTCLIHGWGKVTMKEKSA---SLQQAPVPILNKELCQ---------VIYKLPASQMC 217
            .|.:   |..|:.:|||    ||:..   .:::..:|::.:..|.         ..|.|....:|
Mosquito   121 QPTDEFVGQRCVSNGWG----KERGVYANVMKKLTLPVIGRANCTRMLRYAGLGPFYTLREGFLC 181

  Fly   218 AGFLQGGIDACQGDSGGPLICDGR-----LAGIISWGVGCADPGYPGVYTNVSHFLKWI------ 271
            ||. :..:|.|:||.|.||.|...     ||||:|||:||.....||||..|:.:::|:      
Mosquito   182 AGG-EVAVDMCKGDGGSPLACQTESGTYVLAGIVSWGIGCGGFNTPGVYVAVNRYVQWLNEHIVD 245

  Fly   272 RRANASLD 279
            :..|.|.|
Mosquito   246 QALNESFD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 73/252 (29%)
Tryp_SPc 38..273 CDD:238113 74/260 (28%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 74/255 (29%)
Tryp_SPc 7..238 CDD:214473 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.