DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP006707

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_309036.1 Gene:AgaP_AGAP006707 / 1270350 VectorBaseID:AGAP006707 Length:255 Species:Anopheles gambiae


Alignment Length:260 Identity:75/260 - (28%)
Similarity:123/260 - (47%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATASPFVILP---KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC 87
            :|...|.::|.   ::|||........|:|||::..       |.||.|||::::.|.|.:||||
Mosquito    16 SAAKLPKLVLDDGYRVVGGEVAKNGSAPYQVSLQIP-------GHGHNCGGSLLNSRWVLTAAHC 73

  Fly    88 YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFI 152
                    :|..:|....|:.|::::....   |.|...::. |.:|......|||.|:.|...:
Mosquito    74 --------IVGHEPTNIQVLVGTNSLKEGG---QLYKPDKLF-HHNYASPEFRNDIGLIRLKEEV 126

  Fly   153 PWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIYKLP---- 212
            .: |..|::|..:.:......|..:.|||:.:......: ||...|..|..|.|:.....|    
Mosquito   127 QF-SEIVQSIEYSEQVVPANVTVRLTGWGRTSAGGSVPTLLQSLNVVTLTNEDCKAKSLYPEHVD 190

  Fly   213 ASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            ...:|. ..:.|..||.|||||||:.:|:|.|::::||.|. .|||..:..||::..|||...|:
Mosquito   191 VGHLCT-LSRSGEGACNGDSGGPLVYEGKLVGVVNFGVPCG-LGYPDGFARVSYYHDWIRTTMAN 253

  Fly   278  277
            Mosquito   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 68/238 (29%)
Tryp_SPc 38..273 CDD:238113 70/239 (29%)
AgaP_AGAP006707XP_309036.1 Tryp_SPc 30..247 CDD:214473 68/238 (29%)
Tryp_SPc 31..250 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.