DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CTR1_ANOGA

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_309033.2 Gene:CTR1_ANOGA / 1270348 VectorBaseID:AGAP006709 Length:259 Species:Anopheles gambiae


Alignment Length:246 Identity:75/246 - (30%)
Similarity:120/246 - (48%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ::|||........|:|||::..       |.||.|||::::.|.|.:||||        ||...|
Mosquito    32 RVVGGEVAKNGSAPYQVSLQVP-------GWGHNCGGSLLNDRWVLTAAHC--------LVGHAP 81

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI 166
            ...:|:.|::::.......:   |.:::.|..||.....|||.|:.|...:.: |..|:::..:.
Mosquito    82 GDLMVLVGTNSLKEGGELLK---VDKLLYHSRYNLPRFHNDIGLVRLEQPVRF-SELVQSVEYSE 142

  Fly   167 KAPEEGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIYKLP----ASQMCAGFLQGGID 226
            ||.....|..:.|||..:....|.: ||...|..|:.|.|......|    ...:|. ..:.|..
Mosquito   143 KAVPANATVRLTGWGHTSANGPSPTLLQSLNVVTLSNEDCNKKGGDPGYTDVGHLCT-LTKTGEG 206

  Fly   227 ACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            ||.|||||||:.:|:|.|::::||.|| .|||..:..||::..|:|...|:
Mosquito   207 ACNGDSGGPLVYEGKLVGVVNFGVPCA-LGYPDGFARVSYYHDWVRTTMAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 72/238 (30%)
Tryp_SPc 38..273 CDD:238113 73/239 (31%)
CTR1_ANOGAXP_309033.2 Tryp_SPc 32..250 CDD:214473 72/238 (30%)
Tryp_SPc 33..253 CDD:238113 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.