DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPA10

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_308802.3 Gene:CLIPA10 / 1270130 VectorBaseID:AGAP006954 Length:1130 Species:Anopheles gambiae


Alignment Length:255 Identity:77/255 - (30%)
Similarity:115/255 - (45%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPL--------VYRDPELY 104
            :.|:||::.::...|..|    ||||.:|....:.:||||........|        |..|.|.|
Mosquito   893 EYPWQVAILKKDPKESVY----VCGGTLIDNLYIITAAHCVKTYNGFDLRVRLGEWDVNHDVEFY 953

  Fly   105 VVVAGSSAIDRTDRFTQEYLVQRIVG---HKDYNGSTLENDIALLFLNGFIPWES-PGVRAIPLA 165
                             .|:.:.|:.   |.:|...||:||:|:|.::..:...| |.:....|.
Mosquito   954 -----------------PYIERDIISVQVHPEYYAGTLDNDLAILKMDRPVDLTSAPHIAPACLP 1001

  Fly   166 IKAPE-EGTTCLIHGWGKVTMKEKSA---SLQQAPVPILNKELCQ---------VIYKLPASQMC 217
            .|..: .|..|...||||....:...   .|::..|||:|...||         ..|.|....:|
Mosquito  1002 DKHTDFSGQRCWTTGWGKDAFGDYGKYQNILKEVDVPIVNHYQCQNQLRQTRLGYTYNLNQGFIC 1066

  Fly   218 AGFLQGGIDACQGDSGGPLICD----GRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            ||. :.|.|||:||.||||:|:    .::.|::|||:||.....||||..|:|:|.||.:
Mosquito  1067 AGG-EEGKDACKGDGGGPLVCERNGVWQVVGVVSWGIGCGQANVPGVYVKVAHYLDWINQ 1125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 75/251 (30%)
Tryp_SPc 38..273 CDD:238113 77/253 (30%)
CLIPA10XP_308802.3 Tryp_SPc 888..1126 CDD:238113 77/255 (30%)
Tryp_SPc 888..1123 CDD:214473 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.