DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPB1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_307756.2 Gene:CLIPB1 / 1269160 VectorBaseID:AGAP003251 Length:372 Species:Anopheles gambiae


Alignment Length:297 Identity:84/297 - (28%)
Similarity:136/297 - (45%) Gaps:43/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHV 70
            :|..:|...:|...:.:..|.......:.:.:||||....||..|:...::......|:   |..
Mosquito    83 VCCPLVRKLTGRFDAPVELPPPGECGKMQMDRIVGGGVSPIDGYPWLTRIQYYKGSNRY---GFH 144

  Fly    71 CGGAVISQRVVCSAAHCYAINTSVPLVYR------DPELYVVVAGSSAIDRTDRFTQEYLVQRIV 129
            |||.:|..:.|.:||||.....|..:||:      |....:........|.    .::.|:...|
Mosquito   145 CGGVLIHNQYVLTAAHCIEGVPSTWIVYQVRLGEFDTTTTIDCVEDDCADP----VRDVLINAYV 205

  Fly   130 GHKDY---NGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTT-------CLIHGWGKVT 184
            .|.||   ||:.. ||||||.|:..:.: :..:|  |:.:...||..|       ..:.|||:..
Mosquito   206 VHPDYYKQNGADY-NDIALLQLSETVEF-TDFIR--PICLPTSEESRTVNLTGKYATVAGWGQTE 266

  Fly   185 MKEKSASLQQAPVPILNKELC-----QVIYKLPASQMCAGFLQGGIDACQGDSGGPLI--CDGR- 241
            ....|.......||:::.|:|     .:..::..:|:|||. :.|.|:|:|||||||:  .||| 
Mosquito   267 NSTSSTKKLHLRVPVVDNEVCADAFSSIRLEIIPTQLCAGG-EKGKDSCRGDSGGPLMRYGDGRS 330

  Fly   242 ------LAGIISWGV-GCADPGYPGVYTNVSHFLKWI 271
                  |.|::|:|: .|...|.|||||.:|.::.|:
Mosquito   331 STKSWYLIGLVSFGLEQCGTDGVPGVYTRMSEYMDWV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/264 (30%)
Tryp_SPc 38..273 CDD:238113 80/265 (30%)
CLIPB1XP_307756.2 CLIP 32..85 CDD:288855 0/1 (0%)
Tryp_SPc 114..367 CDD:214473 79/264 (30%)
Tryp_SPc 115..367 CDD:238113 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.