DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP012692

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_307636.4 Gene:AgaP_AGAP012692 / 1269055 VectorBaseID:AGAP012692 Length:277 Species:Anopheles gambiae


Alignment Length:261 Identity:73/261 - (27%)
Similarity:114/261 - (43%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 THSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVIS 77
            ||    ||:.|           |.:||.|....|...|:.|.:|..|        ..|||.::|:
Mosquito    42 TH----QSKAG-----------LGRIVNGKNANIASYPYIVRLRVNS--------AGVCGASIIT 83

  Fly    78 QRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLEND 142
            ...|.:||||...|       ::|....:..||::  :|.... .:...:::.|..||..|...|
Mosquito    84 YTHVFTAAHCLYKN-------QNPASITLYGGSTS--QTSGGV-VFFASKVIIHPYYNPETHNYD 138

  Fly   143 IALLFL-NGFIPWESPGVRAI-PLAIKAPE--EGTTCLIHGWGKVTMKEKSA--SLQQAPVPILN 201
            ..::.: |.|     .|.:.| |:|::..|  ..|||...|||......|::  :||.|.:.:::
Mosquito   139 AGIVQIKNSF-----QGYKNIAPIALQDAEVPSDTTCYAAGWGYNNYDRKTSPDNLQYATLQVIS 198

  Fly   202 KELCQVIYKLPASQ--MCAGFLQGGIDACQGDSGGPLICDGRLAGIISW-GVGCADPGYPGVYTN 263
            .:.|...:...|:.  :||.....| |.|.||||||.:|:.:|.|..|: ||.|... .|..:|.
Mosquito   199 PQQCSAAWSGYATPQFICAQQNNNG-DVCNGDSGGPFVCNDKLTGATSYGGVACRGK-LPSAFTK 261

  Fly   264 V 264
            |
Mosquito   262 V 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 67/237 (28%)
Tryp_SPc 38..273 CDD:238113 67/236 (28%)
AgaP_AGAP012692XP_307636.4 Tryp_SPc 51..264 CDD:214473 67/237 (28%)
Tryp_SPc 52..274 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.