DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Cfi

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_031712.2 Gene:Cfi / 12630 MGIID:105937 Length:603 Species:Mus musculus


Alignment Length:258 Identity:77/258 - (29%)
Similarity:121/258 - (46%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC--------YAINTS 93
            :::||....:...|:||:::.        |....|||..|....:.:||||        |.:.|:
Mouse   360 RVIGGKPANVGDYPWQVAIKD--------GQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTA 416

  Fly    94 VPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL---NGFIPWE 155
            : |.:..|...:.:               ..|:|::.|:.|||:|.:|||||:.:   .|....|
Mouse   417 L-LDWLKPNSQLGI---------------QTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECE 465

  Fly   156 SPGVRAIPLAIK-AP---EEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK---LPA 213
            .|  .::|..:. :|   :....|:|.|||:....:|..||:...|.::..  |...|.   ...
Mouse   466 LP--NSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGN--CSQFYPDRYYEK 526

  Fly   214 SQMCAGFLQGGIDACQGDSGGPLICDG-----RLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ...|||...|.||||:|||||||:|:.     .:.||:|||..|..|.:|||||.|:::..||
Mouse   527 EMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWI 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 75/256 (29%)
Tryp_SPc 38..273 CDD:238113 77/257 (30%)
CfiNP_031712.2 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 232..261 CDD:238060
LDLa 264..298 CDD:294076
Tryp_SPc 360..589 CDD:214473 75/256 (29%)
Tryp_SPc 361..592 CDD:238113 77/257 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.