DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Ctrl

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:257 Identity:79/257 - (30%)
Similarity:120/257 - (46%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||.|........|:|||::..:      |. |.|||::|:...|.:||||..          .|
  Rat    33 RIVNGENAVPGSWPWQVSLQDNT------GF-HFCGGSLIAPNWVVTAAHCKV----------TP 80

  Fly   102 ELYVVVAGSSAIDRTDRF--TQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG---VRA 161
            ..:.|:.|.  .||:...  .|...:.:.:.|..:|.:|:.||:.||.|      .||.   .:.
  Rat    81 GRHFVILGE--YDRSSNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKL------ASPARYTAQV 137

  Fly   162 IPLAIKAPEE----GTTCLIHGWGKVT--MKEKSASLQQAPVPILNKELCQVIY--KLPASQMCA 218
            .|:.:.:..|    |.||:..|||:::  .....|.|||..:|::....|:..:  ::..|.:||
  Rat   138 SPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSRITDSMICA 202

  Fly   219 GFLQGGIDACQGDSGGPLICD-GR---LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANA 276
            |  ..|..:|||||||||:|. |.   |.||:|||....:...|.:||.||.|..||.:..|
  Rat   203 G--GAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTENCNVQAPAMYTRVSKFNTWINQVIA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/250 (30%)
Tryp_SPc 38..273 CDD:238113 78/251 (31%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 76/250 (30%)
Tryp_SPc 34..260 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.