DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss29

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:278 Identity:91/278 - (32%)
Similarity:130/278 - (46%) Gaps:57/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG-HVCGGAVISQRVVCSAAHCYA 89
            |....|..:|..||||::....:.|:|||:|   |:..::... |.|||::|..:.|.:||||..
Mouse    19 TPAPGPEGVLMGIVGGHSAPQGKWPWQVSLR---IYRYYWAFWVHNCGGSIIHPQWVLTAAHCIR 80

  Fly    90 INTSVPLVYR----DPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNG 150
            ...:.|.|:|    :..||   .|...:.          |.|::.|.|:..:.|.:|:|||.|  
Mouse    81 ERDADPSVFRIRVGEAYLY---GGKELLS----------VSRVIIHPDFVHAGLGSDVALLQL-- 130

  Fly   151 FIPWESPGVRAIP--LAIKAPEEG------TTCLIHGWGKVTMKEK---SASLQQAPVPILNKEL 204
                 :..|::.|  ..:|.|.|.      ..|.:.|||.|:....   ...|||..|.|::..|
Mouse   131 -----AVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSL 190

  Fly   205 CQVIY-----------KLPASQM-CAGFLQGGIDACQGDSGGPLICD----GRLAGIISWGVGCA 253
            |:.:|           ||....| |||  ..|.|:|.|||||||:|:    ..|.|::|||.|||
Mouse   191 CEEMYHNATRHRNRGQKLILKDMLCAG--NQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCA 253

  Fly   254 DPGYPGVYTNVSHFLKWI 271
            ...:||||..|..||.||
Mouse   254 LRDFPGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/265 (32%)
Tryp_SPc 38..273 CDD:238113 88/266 (33%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 88/266 (33%)
Tryp_SPc 31..271 CDD:214473 86/264 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.