DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss28

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:261 Identity:75/261 - (28%)
Similarity:120/261 - (45%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPE 102
            ||||......:.|:|||:|..|.....:  .|:|||::|..:.:.:||||.....:.|.|||   
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSW--VHICGGSIIHPQWILTAAHCIQSQDADPAVYR--- 90

  Fly   103 LYVVVAGSSAIDRTDRFTQEYL-VQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI 166
               |..|...:.:    .||.| :.||:.|.|||..:...|:||:.|...:. .|..|..:.|  
Mouse    91 ---VQVGEVYLYK----EQELLNISRIIIHPDYNDVSKRFDLALMQLTALLV-TSTNVSPVSL-- 145

  Fly   167 KAPEEGTT------CLIHGWGKVTMK---EKSASLQQAPVPILNKELCQVIYKLPAS-------- 214
              |::.:|      |.:.|||.:..:   :....|.:..:||.:.:.|:..|:..:|        
Mouse   146 --PKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAI 208

  Fly   215 ---QMCAGFLQGGIDACQGDSGGPLIC----DGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
               .:|||  ..|...|.|||||||:|    .....|::|.|:.|:: ..|.:::.|...|.||.
Mouse   209 FDDMLCAG--TSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCSN-NLPSIFSRVQSSLAWIH 270

  Fly   273 R 273
            :
Mouse   271 Q 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 73/257 (28%)
Tryp_SPc 38..273 CDD:238113 75/259 (29%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 75/261 (29%)
Tryp_SPc 31..269 CDD:214473 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.