DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:250 Identity:95/250 - (38%)
Similarity:132/250 - (52%) Gaps:26/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAIN 91
            |.|.|.....|||||||...:.||:|||:....         |.|||::|:.:.|.||||||  .
Mouse    13 AVAFPVDDDDKIVGGYTCRENSVPYQVSLNSGY---------HFCGGSLINDQWVVSAAHCY--K 66

  Fly    92 TSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES 156
            |.:.:...:..:.|:......||          ..:|:.|.::|..||.|||.|:.|:..:...:
Mouse    67 TRIQVRLGEHNINVLEGNEQFID----------AAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNA 121

  Fly   157 PGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELCQVIY--KLPASQMC 217
             .|..:.|.......||.|||.|||.......|..  ||....|:|.:..|:..|  |:..:.:|
Mouse   122 -RVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNMVC 185

  Fly   218 AGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            ||||:||.|:||||||||::|:|.|.||:|||.|||.|..|||||.|.:::.||:
Mouse   186 AGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 90/237 (38%)
Tryp_SPc 38..273 CDD:238113 91/238 (38%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 90/237 (38%)
Tryp_SPc 24..242 CDD:238113 91/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.