DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and St14

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:260 Identity:90/260 - (34%)
Similarity:129/260 - (49%) Gaps:47/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ::|||......:.|:|||:..       .|.||:||.::||...:.|||||:...|.  ..|.|.
  Rat   614 RVVGGTNADEGEWPWQVSLHA-------LGQGHLCGASLISPDWLVSAAHCFQDETI--FKYSDH 669

  Fly   102 ELYVVVAGSSAIDRTDRF---TQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG----- 158
            .::....|  .:|::.|.   .||:.::||:.|..:|..|.:.|||||.|      |.|.     
  Rat   670 TMWTAFLG--LLDQSKRSASGVQEHKLKRIITHPSFNDFTFDYDIALLEL------EKPAEYSTV 726

  Fly   159 VRAIPLAIKAPEE------GTTCLIHGWGKVTMKEKSAS---LQQAPVPILNKELCQVI--YKLP 212
            ||.|.|    |:.      |....:.|||..  ||....   ||:..:.::|:..|:.:  .::.
  Rat   727 VRPICL----PDNTHVFPAGKAIWVTGWGHT--KEGGTGALILQKGEIRVINQTTCEELLPQQIT 785

  Fly   213 ASQMCAGFLQGGIDACQGDSGGPLIC---DGRL--AGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            ...||.|||.||:|:|||||||||..   |||:  ||::|||.|||....|||||.:.....||:
  Rat   786 PRMMCVGFLSGGVDSCQGDSGGPLSSVEKDGRIFQAGVVSWGEGCAQRNKPGVYTRIPEVRDWIK 850

  Fly   273  272
              Rat   851  850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/257 (34%)
Tryp_SPc 38..273 CDD:238113 90/259 (35%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 90/259 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.