DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC11175927

DIOPT Version :10

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_003436543.2 Gene:LOC11175927 / 11175927 VectorBaseID:AGAMI1_011682 Length:318 Species:Anopheles gambiae


Alignment Length:37 Identity:8/37 - (21%)
Similarity:18/37 - (48%) Gaps:7/37 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YTDEELLTQAKLVYTNIVIEMDHLVKAMPAAGLNFSD 97
            |:..:|||.:.|.|.:.::..:       ..|.:::|
Mosquito    97 YSAVDLLTLSPLGYASYLVYKN-------GGGFDYND 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 38..273 CDD:238113 8/37 (22%)
LOC11175927XP_003436543.2 None

Return to query results.
Submit another query.