DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:288 Identity:78/288 - (27%)
Similarity:116/288 - (40%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATASPFV--------ILPKIVGGYTVTIDQVPFQ--VSVRRRSIHERHYGLGHVCGGAVISQRV 80
            |....||.        ::..||||......:.|.|  :...|.......|...  |||::||.|.
Mosquito    52 TLNPKPFYYQSYNCSNVVDLIVGGEAAKHGEFPHQALLGYPREDGSPEPYSFS--CGGSLISDRF 114

  Fly    81 VCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRT-DRFTQ-EYLVQRIVGHKDYNGSTLENDI 143
            :.:||||::        |.||    |:......|.| |..|| ::.:..|:.|..|..|...:|:
Mosquito   115 ILTAAHCFS--------YGDP----VIVRLGEYDLTVDSTTQLDFGIAEIIRHPKYRNSRSYHDL 167

  Fly   144 ALLFLNGFI-------P---WESPGV---RAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQA 195
            ||:.||..:       |   |.:|.:   |.:.......|||:|.|            |..|.:.
Mosquito   168 ALVRLNETVLFSKVIRPACLWTNPTLNVSRFVATGFGKQEEGSTDL------------STKLMKV 220

  Fly   196 PVPILNKELCQVIYK--------LPASQMCAGFLQGGIDACQGDSGGPL-------ICDGRLAGI 245
            .:.:.....|..:::        :...|:|.|.|.||.|.|||||||||       .|...:.|:
Mosquito   221 QLDLFPSSDCGELFRDNRKFRDGIDEGQLCVGSLIGGKDTCQGDSGGPLQTITEPRSCIYNIVGV 285

  Fly   246 ISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            .|.|..|.......:|:.|:|:|.||.:
Mosquito   286 TSTGAACGVGNSKAIYSKVAHYLDWIEQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 73/265 (28%)
Tryp_SPc 38..273 CDD:238113 75/266 (28%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 75/268 (28%)
Tryp_SPc 72..311 CDD:214473 73/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.