DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP013089

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_003436251.1 Gene:AgaP_AGAP013089 / 11175918 VectorBaseID:AGAP013089 Length:634 Species:Anopheles gambiae


Alignment Length:311 Identity:98/311 - (31%)
Similarity:145/311 - (46%) Gaps:65/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQIGQPTATASPFVILP------------------------KIVGGYTVTIDQVPFQVSVRRRSI 60
            |..|..::||.|..:.|                        ::|||....::..|:..::..||.
Mosquito   339 SSSGAGSSTAGPTTVTPSSTGSNRLPTNDVDRCGMSNGTHTRVVGGVDAQLNAWPWMAALGYRST 403

  Fly    61 -HERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAI--DRTDRFTQE 122
             .|.:.|...:|||.:|:...|.:.|||  |.|:         ||.|..|...|  |:......:
Mosquito   404 SFELNAGPRFLCGGTLITTLHVLTVAHC--IQTA---------LYFVRLGELDITSDQDGANPVD 457

  Fly   123 YLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTC-----LIHGWGK 182
            ..:||.|.|:.|:...:.|||||:.|...:. .:..||.|.|.::|.:.....     .|.|||.
Mosquito   458 IYIQRWVVHERYDEKKIYNDIALVLLQKSVT-ITEAVRPICLPVEAKQRTKDLTYYAPFIAGWGA 521

  Fly   183 VTMKEKSAS-LQQAPVPILNKELCQVIYKL--PA-----SQMCAGFLQGGIDACQGDSGGPLI-- 237
            |.....:|: ||:|.|.:|..:.|...|||  |.     :.:||||.|||.|:|||||||||:  
Mosquito   522 VGYNGPTAARLQEAQVVVLPVDQCAFNYKLYFPGQIFDDTVLCAGFPQGGKDSCQGDSGGPLMLP 586

  Fly   238 ---CDGR-----LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANASLDY 280
               .:|:     |.|:||:|..||..|:||||..|:.:|.||   .|:|::
Mosquito   587 ELSSNGQYYYYTLIGLISYGYECARAGFPGVYVKVTAYLPWI---EANLNF 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/259 (34%)
Tryp_SPc 38..273 CDD:238113 90/260 (35%)
AgaP_AGAP013089XP_003436251.1 CLIP 250..304 CDD:288855
Tryp_SPc 380..628 CDD:214473 88/259 (34%)
Tryp_SPc 381..631 CDD:238113 90/264 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.