DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and KLK11

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:300 Identity:85/300 - (28%)
Similarity:136/300 - (45%) Gaps:57/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GITQSQIGQPTATASP-----------FVILPKIVGGYTVTI-------DQVPFQVSVRRRSIHE 62
            |:|.::  :|.|.:||           ..:...:|||.|..|       ...|:|.::..::   
Human    16 GLTAAK--EPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKT--- 75

  Fly    63 RHYGLGHVCGGAVISQRVVCSAAHCYA--INTSVPLVYRDPEL------------YVVVAGSSAI 113
                 ..:||..:|:.|.:.:||||..  ::.:.| .:..|:|            |:|..|...:
Human    76 -----RLLCGATLIAPRWLLTAAHCLKPWVSLTSP-THVSPDLSSSNYCLSHLSRYIVHLGQHNL 134

  Fly   114 DRTDRFTQEYLVQRIVGHKDYNGS----TLENDIALLFLNG--FIPWESPGVRAIPLAIKAPEEG 172
            .:.:...|.........|..:|.|    ...|||.|:.:..  .|.|   .||.:.|:.:....|
Human   135 QKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITW---AVRPLTLSSRCVTAG 196

  Fly   173 TTCLIHGWGKVTMKEKSA--SLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSG 233
            |:|||.|||..:..:...  :|:.|.:.|:..:.|:..|  .:..:.:||...:||.|:||||||
Human   197 TSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSG 261

  Fly   234 GPLICDGRLAGIISWGVG-CADPGYPGVYTNVSHFLKWIR 272
            |||:|:..|.||||||.. ||....|||||.|..::.||:
Human   262 GPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/265 (29%)
Tryp_SPc 38..273 CDD:238113 79/266 (30%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 73/258 (28%)
Tryp_SPc 54..303 CDD:238113 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.