DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC103908930

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:242 Identity:81/242 - (33%)
Similarity:122/242 - (50%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ||:|||....:..|:|:.:....  :|.      ||.::|::....|||||   |...       
Zfish    20 KIIGGYECPPNSQPWQIYITNDG--QRW------CGASLINESWAVSAAHC---NIGA------- 66

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG-----VRA 161
            .|..|..|...||..::..|....:::..|.::...:.:|||.|:.|      :.|.     |:.
Zfish    67 NLLTVYLGKHNIDVVEKTEQRIRTEKVFPHPEFKFPSEDNDIMLIKL------KDPAVFNQYVQP 125

  Fly   162 IPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGG 224
            ||||.....||..||:.|||...:...|. ||...:.:.:::.|:.:|  |...:.:||||::||
Zfish   126 IPLATSCSSEGEQCLVSGWGYTEVGLPSV-LQCLDLAVQSRQECERVYKDKFTQNMLCAGFMEGG 189

  Fly   225 IDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ...|.|||||||:|:|.|.|::|||.|||:||||.||..|..:..||
Zfish   190 KGVCHGDSGGPLVCNGELRGVVSWGAGCAEPGYPAVYVEVCRYSDWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/240 (33%)
Tryp_SPc 38..273 CDD:238113 80/241 (33%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.