DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC102553861

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001316820.1 Gene:LOC102553861 / 102553861 RGDID:7500593 Length:248 Species:Rattus norvegicus


Alignment Length:255 Identity:75/255 - (29%)
Similarity:117/255 - (45%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAI 90
            |.:.:|.....:|:||:.......|:...::.::...|    ..:|||.:|.:..|.:||||...
  Rat     9 TVSLAPTTEAAEIIGGHEADPHSRPYMAYLQYKNEDSR----DTICGGFLIREDFVLTAAHCSGS 69

  Fly    91 NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE 155
            ..:|.|            |:..|...::..|...|.:|:.|..||..|:.|||.||.|..    :
  Rat    70 KINVTL------------GAHNIKEQEKTQQVIPVVKIIPHPAYNAKTISNDIMLLKLKS----K 118

  Fly   156 SPGVRAI-----PLAIKAPEEGTTCLIHGWGKV-TMKEKSASLQQAPVPILNKELCQVIYKL--- 211
            :...||:     |.:....:.|..|.:.||||: .|.:....||:..:.:...:.|:...|.   
  Rat   119 AKRTRAVKTLSLPRSNFKVKPGDVCYVAGWGKLGPMGKFPDKLQEVELTVQEDQECETYLKNAYD 183

  Fly   212 PASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            .|:|:|||..:....:.||||||||:|....|||:|:  |..|...|..:|.||.||.||
  Rat   184 KANQICAGDPKIKCASFQGDSGGPLVCKKVAAGIVSY--GRKDGSTPRAFTKVSTFLSWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/242 (29%)
Tryp_SPc 38..273 CDD:238113 73/243 (30%)
LOC102553861NP_001316820.1 Tryp_SPc 20..241 CDD:214473 71/242 (29%)
Tryp_SPc 21..244 CDD:238113 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.