DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk15

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:271 Identity:66/271 - (24%)
Similarity:88/271 - (32%) Gaps:108/271 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            :|:.|..:..   ::.:|.|.            |::.|........|:||::..|....      
  Rat     1 MWLLLAFILL---VSAAQDGD------------KVLEGEECVPHSQPWQVALFERGRFN------ 44

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
              ||..:||...|.:||||......|.|            |...:.:.|...|...|.||:.|..
  Rat    45 --CGAFLISPHWVLTAAHCQTRFMRVRL------------GEHNLRKFDGPEQLRSVSRIIPHPG 95

  Fly   134 YNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVP 198
            |...|..:||.||.|  |.|     .|..|                                   
  Rat    96 YEARTHRHDIMLLRL--FRP-----ARLTP----------------------------------- 118

  Fly   199 ILNKELCQVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG-VGCADPGYPGVYT 262
                                          ||||||||:|.|.|.||:||| |.|.....|||||
  Rat   119 ------------------------------QGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYT 153

  Fly   263 NVSHFLKWIRR 273
            .|..::.|||:
  Rat   154 KVCSYMDWIRK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 59/234 (25%)
Tryp_SPc 38..273 CDD:238113 60/235 (26%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.