DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC101734670

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_004920158.2 Gene:LOC101734670 / 101734670 -ID:- Length:275 Species:Xenopus tropicalis


Alignment Length:279 Identity:87/279 - (31%)
Similarity:123/279 - (44%) Gaps:60/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC 87
            |.||...|     .::|.|........|:|||::   ..|....| |.|||.:|:.|.:.:||||
 Frog    18 GVPTYAPS-----ARVVNGENAKPYSWPWQVSLQ---FLEDGVFL-HNCGGTLIADRWILTAAHC 73

  Fly    88 YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLV--QRIVGHKD--YNGSTLENDIALLFL 148
              ||.|  ...|      ||.|...:...:...|.:|:  :.:..|:.  ||.....|||||:.|
 Frog    74 --INFS--WTNR------VVVGDYDLANEEGAEQIFLIPSEDMFVHQSWKYNCIPCGNDIALIRL 128

  Fly   149 NGFIPWESPGVRAIPLAIKA-----PEEGT------TCLIHGWGKV-TMKEKSASLQQAPVPILN 201
            :          |.:.::.|.     |..|.      :|...|||:: |.......||||.:|:::
 Frog   129 S----------RPVQISDKVQLSCLPPAGELLPNNFSCYASGWGRLYTGGPIPDILQQALLPVVD 183

  Fly   202 KELCQVI----YKLPASQMCAGFLQGGI-DACQGDSGGPLIC---DGR--LAGIISW--GVGCAD 254
            ...|...    .|:..|.:|||   |.| ..|.|||||||.|   |||  :.|:.|:  |.||..
 Frog   184 HNHCTQRDWWGTKVKRSMVCAG---GDIRSVCNGDSGGPLNCQGADGRWYVHGVASFVHGYGCNT 245

  Fly   255 PGYPGVYTNVSHFLKWIRR 273
            ...|.|:|.||.|..||::
 Frog   246 LKKPSVFTRVSAFNSWIQQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/261 (31%)
Tryp_SPc 38..273 CDD:238113 83/262 (32%)
LOC101734670XP_004920158.2 Tryp_SPc 28..265 CDD:238113 83/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.