DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC101732176

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:251 Identity:90/251 - (35%)
Similarity:134/251 - (53%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG---HVCGGAVISQRVVCSAAHCYAINTSVPLVY 98
            :||||........|:|:|:.:.        :|   ::|||::|:...:.:||||....||.|.::
 Frog   276 RIVGGTFALAGDWPWQISLMKL--------VGTSLYLCGGSIITPYWIVTAAHCVYGYTSSPSIF 332

  Fly    99 RDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163
            :      |.|||..:  ::.::..|||.|::.|..|:.:|...|||||.|...:.: |..:|.:.
 Frog   333 K------VFAGSLTL--SNYYSAGYLVDRVLIHPSYSPNTQNYDIALLKLKTALVF-STNLRPVC 388

  Fly   164 LA-IKAP-EEGTTCLIHGWGKVTMKEK---SASLQQAPVPILNKELCQV--IY--KLPASQMCAG 219
            |. :..| .:|..|.|.|||  |..|.   |.||:.|.|||::...|.:  :|  .:..:.:|||
 Frog   389 LPNVGMPWADGQPCWISGWG--TTSEAGSISTSLKAASVPIISSATCNLAPVYGGVISPTMICAG 451

  Fly   220 FLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :|.||.|.|||||||||:....    |.|..|||.|||....||||.|::.||:||
 Frog   452 YLGGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGVYGNITVFLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/249 (35%)
Tryp_SPc 38..273 CDD:238113 90/250 (36%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055
Tryp_SPc 277..510 CDD:238113 90/250 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.