DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and prss56

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:310 Identity:101/310 - (32%)
Similarity:148/310 - (47%) Gaps:46/310 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TQSQIGQPTATASPFVIL-----PK--IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAV 75
            |....|.|......|..:     ||  ||||...:....|:.|::|        :....:|||.:
 Frog    48 TSPDDGSPVTCGQKFSSISNNTGPKGRIVGGSITSPGSWPWLVNIR--------FNGELMCGGVL 104

  Fly    76 ISQRVVCSAAHCY--AINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGST 138
            :....:.:||||:  ::|         ..|:.||.|...:.:..:..:.:.|.|||.|..:|..|
 Frog   105 LDDMWILTAAHCFTGSVN---------EVLWTVVVGQYDLTKNAQGEKTFQVNRIVTHPKFNQKT 160

  Fly   139 LENDIALLFLNGFIPWESPGVR--AIPLAIKAPEEGTTCLIHGWGKVTMKEK---SASLQQAPVP 198
            .:||:|||.|...:. .|...|  .:|...:.|..||.|.|.|||  ::.|.   |..:.:|.||
 Frog   161 FDNDLALLELTSSVT-ASQSARPVCLPPVPRDPTPGTNCYIAGWG--SLYEDGPLSDVIMEARVP 222

  Fly   199 ILNKELCQVIY---KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLA------GIISWGVGCAD 254
            :|::|.|:...   .|.::..|||:|.||||:|||||||||.|...::      ||.|||.||.:
 Frog   223 VLSQEACRSTLGKNMLTSTMFCAGYLNGGIDSCQGDSGGPLTCQDPISKQYVLYGITSWGDGCGE 287

  Fly   255 PGYPGVYTNVSHFLKWI-RRANASLDYSEYR--QIPPLNLASRRSVSSSC 301
            .|.|||||.|:.|..|| .:.|.|....|..  ::..|.:...:.|||.|
 Frog   288 RGKPGVYTRVTAFTDWISHQMNKSPPIREPTCFELSELGILHEKGVSSIC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/251 (34%)
Tryp_SPc 38..273 CDD:238113 87/251 (35%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 86/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.