DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss50

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017451624.2 Gene:Prss50 / 100910205 RGDID:6499372 Length:424 Species:Rattus norvegicus


Alignment Length:316 Identity:76/316 - (24%)
Similarity:119/316 - (37%) Gaps:90/316 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QSQIGQPTATASPFVILPKIVG-----GYTVTIDQV----------------------------P 50
            |.|....:.|.:|    ||.:|     |.|.::.:.                            |
  Rat   104 QDQTSDTSQTTTP----PKGMGALSTVGITGSVSKTKPGNLPLCGSSQEPDPTLRDPEAMTRRWP 164

  Fly    51 FQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDR 115
            :.|||:...        .|||.|.:|:.:.|.:.|||.:.|.         ..|.|..||..|::
  Rat   165 WMVSVQTNG--------SHVCAGILIASQWVLAVAHCLSQNR---------VNYTVRVGSPWINQ 212

  Fly   116 TDRFTQEYLVQRIVGHKDYNGSTL------ENDIALLFLNGFIPWES-------PGVRAIPLAIK 167
            |...:.:..|.:::.:..|.....      .:||.||.|...:.:..       ||:..:     
  Rat   213 TTETSSDVPVNQVIINSGYQSKRYWSWVGRIHDIGLLKLKWGLKYSKYVWPVCLPGLEYV----- 272

  Fly   168 APEEGTTCLIHGWG--KVT-MKEKSASLQQAPVPILNKELCQVIY----------KLPASQMCAG 219
             .|:|:.|.:.|||  |.. :..:..:||:..|.|||...|:..|          ::.:.||...
  Rat   273 -VEDGSLCTVTGWGYPKANGLWPQFQTLQEKEVSILNSRECEHYYHKFSRIHSLVRIISPQMICA 336

  Fly   220 FLQGGIDACQGDSGGPLIC--DGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ........|...||.||:|  ||.  |.|::|||.||.....|.::..|||:..||
  Rat   337 LDNDREKFCYERSGEPLVCSSDGMWYLVGVMSWGPGCKKSEAPPIFLQVSHYQLWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 69/296 (23%)
Tryp_SPc 38..273 CDD:238113 70/297 (24%)
Prss50XP_017451624.2 Tryp_SPc 162..392 CDD:238113 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.