DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and ovch2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:319 Identity:98/319 - (30%)
Similarity:146/319 - (45%) Gaps:72/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYA 89
            |..:|.....|.:||||......|.|:.||::|..        .|.|||.::|:|.|.:|:||  
 Frog    51 PLGSARDLNYLSRIVGGRESKKGQHPWTVSLKRNG--------KHFCGGILVSRRHVLTASHC-- 105

  Fly    90 INTSVPLVYRDPELYV-VVAGSSAIDRT--DRFTQEYLVQRIVGHKDYNGSTLEN-DIALLFLNG 150
                  |:.|:.:.|: |..|.  .|:|  :...|.:.|..|..|.|:|.:...| |:|:|.|:|
 Frog   106 ------LLDRNVKSYIRVFFGE--YDQTIKEDTEQTFKVIEIFKHPDFNYTQPMNYDVAVLVLDG 162

  Fly   151 FIPWESPGVRAIPLAIKAP----EEGTTCLIHGWGKVTMKEKS---ASLQQAPVPILNKELC-QV 207
            .:.::.   ...|..:..|    |.|..|:..|||.:|  |..   ..||:..:|::|..:| .|
 Frog   163 AVTFDD---NIQPACMPNPDDVFEPGDLCVTLGWGHLT--ENGILPGVLQEVLLPLVNLSICLDV 222

  Fly   208 IYKLPASQ-----MCAGFLQGGIDACQGDSGGPLICDGR-----LAGIISWGVGCA--------- 253
            :..|..:.     :||||.:||.|||||||||||:|..|     |.|:.|||:||.         
 Frog   223 MATLKGAVVSSKIVCAGFPEGGKDACQGDSGGPLLCQRRHGTWVLHGLTSWGMGCGRSWKNNMFL 287

  Fly   254 ---DPGYPGVYTNVSHFLKWIRRANASLDYSEYRQIPPLNLASRRSVSSSC-LGIGVLA 308
               ..|.||::|::...|.|:..              .||.|..:....|| :..|||:
 Frog   288 PANRKGSPGIFTDIQKLLGWVSF--------------QLNTAVTKESKESCSVQDGVLS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/267 (32%)
Tryp_SPc 38..273 CDD:238113 87/268 (32%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 87/267 (33%)
CUB 330..436 CDD:238001 2/3 (67%)
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.