DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and hgf

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_002933142.2 Gene:hgf / 100495840 XenbaseID:XB-GENE-999992 Length:710 Species:Xenopus tropicalis


Alignment Length:258 Identity:67/258 - (25%)
Similarity:110/258 - (42%) Gaps:53/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ::|.|......:| :.||||.|:.|:        |||.:|.:..|.:|..|:....:   ..:|.
 Frog   477 RVVNGIPTQTRKV-WMVSVRYRNSHK--------CGGTLIKENWVLTARQCFLSGDN---DLKDY 529

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIV-GHKDYNGSTLENDIALL------FLNGFIPWESPGV 159
            |.::.|  .:....|::..|...:.::| |.|..|       :.||      .||.::.      
 Frog   530 EAWLGV--HNIYSTTEKHKQVLNISQLVHGPKGSN-------LVLLKLSRPATLNAYVD------ 579

  Fly   160 RAIPLAIKAPE------EGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK----LPAS 214
                 .||.|.      |.|.|.::|||.....:....||:..:.|:..|.|...:|    :..|
 Frog   580 -----RIKLPNYGCTIPENTMCSVYGWGHTGTNDYDGQLQEGTLHIVGNEKCNEHHKGKITVNES 639

  Fly   215 QMCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            ::||......|..|:.|.||||||:..    :.|:|..|.|||....|.::..|:::.|||.:
 Frog   640 EICAMSETANIGPCERDYGGPLICEENRTHLVQGVIIPGRGCAIQKRPVIFVRVAYYAKWIHK 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 65/254 (26%)
Tryp_SPc 38..273 CDD:238113 67/255 (26%)
hgfXP_002933142.2 PAN_AP_HGF 26..109 CDD:238532
KR 113..195 CDD:214527
KR 197..275 CDD:214527
Kringle 289..367 CDD:333799
KR 373..454 CDD:238056
Tryp_SPc 478..703 CDD:238113 67/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.