DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and f12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:300 Identity:106/300 - (35%)
Similarity:151/300 - (50%) Gaps:54/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATHSGITQS-----------QIGQPTATASPF----VILPKIVGGYTVTIDQVPFQVSVRRRSIH 61
            :.||..|.|           :|..|......|    .|:|:||||........|:..::      
 Frog   318 SNHSASTPSPSNDTQGPVDGRIDLPVDCGRKFQKTPSIMPRIVGGLVALPASHPYIAAL------ 376

  Fly    62 ERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQ 126
               |...|.|||::||...:.:||||.....:|..:       .||.|.|..:.||:.|...||:
 Frog   377 ---YIDNHFCGGSLISPCWIVTAAHCLDQRPNVTKI-------SVVLGQSRFNTTDQHTVTLLVE 431

  Fly   127 RIVGHKDYNGSTLENDIALL---FLNGFIPWE-SPGVRAI--PLAIKAPEEGTTCLIHGWGKVTM 185
            :.:.|:.|.|.||::||||:   .:||....| |..|:.|  |...|..|....|::.|||.   
 Frog   432 KYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICLPQQFKMAESTKQCVVAGWGH--- 493

  Fly   186 KEKSAS-----LQQAPVPILNKELCQ--VIY--KLPASQMCAGFLQGGIDACQGDSGGPLIC--D 239
            :.:.|.     ||:|.:||:....||  .::  ::....:||||::||:|||||||||||:|  |
 Frog   494 QYEGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRMLPGMLCAGFMEGGVDACQGDSGGPLVCEVD 558

  Fly   240 GR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            ||  |.|::|||.|||:...|||||.|:.:..|| |||.|
 Frog   559 GRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWI-RANIS 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 91/252 (36%)
Tryp_SPc 38..273 CDD:238113 93/253 (37%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 94/255 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.