DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tmprss12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_038936305.1 Gene:Tmprss12 / 100362912 RGDID:2323781 Length:427 Species:Rattus norvegicus


Alignment Length:263 Identity:83/263 - (31%)
Similarity:128/263 - (48%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :|:||........|:|||::   :.:.:: |.||||||::..|.|.:|||| ....|.||.:|  
  Rat   155 RIIGGMQANAGAWPWQVSLQ---VQDGNF-LVHVCGGALVRDRWVLTAAHC-TKEASDPLKWR-- 212

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI 166
                .|.|::.:.|:...::...|..||...|:...|..|||||..|.          :|:...:
  Rat   213 ----AVIGTTDLTRSHSHSRSVRVSDIVIQPDFILETFVNDIALFHLK----------KAVRTVL 263

  Fly   167 K---------APEEGTTCLIHGWGKVTMKEKSAS------LQQAPVPILNKELCQ-------VIY 209
            :         :|.:..||:|..|.| |::...|.      ||:|.|..:::|:|.       || 
  Rat   264 QNRGYGGQRLSPWKLHTCVIPEWAK-TIRRSGAPGNGTTILQEAKVHFISREICNSDRSYGGVI- 326

  Fly   210 KLPASQMCAGFLQGGIDACQGDSGGPLIC----DGR--LAGIISWGVGCADPGYPGVYTNVSHFL 268
              |.:..|||...|..|.|:|||||||:|    ..|  :.|:.|:|.||....:||||::.|.|.
  Rat   327 --PNTSFCAGHENGTFDTCRGDSGGPLMCYLTEHKRYFVMGVTSYGHGCGRRHFPGVYSSPSFFQ 389

  Fly   269 KWI 271
            :|:
  Rat   390 QWL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 82/261 (31%)
Tryp_SPc 38..273 CDD:238113 83/262 (32%)
Tmprss12XP_038936305.1 Tryp_SPc 155..391 CDD:214473 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.