DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC100361261

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_038949773.1 Gene:LOC100361261 / 100361261 -ID:- Length:248 Species:Rattus norvegicus


Alignment Length:262 Identity:72/262 - (27%)
Similarity:117/262 - (44%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FVILPK-----IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAIN 91
            |.:.||     |:||:.......|:...::   |.:.:.| ...|||.:|.:..|.:||||..  
  Rat    10 FSLAPKTDAGEIIGGHEAKPHSRPYMAYLQ---IMDENSG-NKTCGGFLIREYFVLTAAHCLG-- 68

  Fly    92 TSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES 156
                      . .:|..|:..|...::..|...:.:|:.|..||..|:.||:.||.|.       
  Rat    69 ----------SXIIVTLGAHNIKEQEKKQQVIPMVKIIPHPAYNAKTISNDLMLLKLK------- 116

  Fly   157 PGVRA----------IPLAIKAPEEGTTCLIHGWGKV-TMKEKSASLQQAPVPILNKELCQV--- 207
              ::|          :|.:....:.|..|.:.||||: .|.:...:||:..:.:...:.|:.   
  Rat   117 --IKAKKTSAVKTLNLPRSNVKVKPGDVCYVAGWGKLGPMGKFPDTLQEVELIVQEDQKCESYLT 179

  Fly   208 -IYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
             :|. .|::.|||..:....:.||||||||:|....|||:|:  ||.|...|..:|.||.||..|
  Rat   180 NVYD-KANEKCAGEPKIKHASFQGDSGGPLVCKKVAAGIVSY--GCKDGSTPRAFTKVSTFLSRI 241

  Fly   272 RR 273
            ::
  Rat   242 KK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 69/253 (27%)
Tryp_SPc 38..273 CDD:238113 69/249 (28%)
LOC100361261XP_038949773.1 Tryp_SPc 21..244 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.