DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and proc.2

DIOPT Version :10

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:84 Identity:20/84 - (23%)
Similarity:38/84 - (45%) Gaps:13/84 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 EYNEVLFEDETTN--RMIESMRLFESICNSRWFHNTNIILFLNKKDLFEEKIKKENIHKAFPEYR 294
            ||:::|:..:...  :.||:..:.:::...|..  .||.:.:......:||||:.      |..|
 Frog   116 EYSQILYSSKLYRFFKYIENRDVAKTVLKERGL--KNIRIGIEGYPTCKEKIKRR------PGGR 172

  Fly   295 GE--QNYAETVAFIKTKFE 311
            .|  .||.:. .||:..:|
 Frog   173 SEVIYNYVQR-PFIQMSWE 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 38..273 CDD:238113 8/42 (19%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503