DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and gzma

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:273 Identity:82/273 - (30%)
Similarity:124/273 - (45%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHV------CGGAVISQRVVCSAAHCY 88
            |..::|..|.|...:.|      :..|..:.|.|.| :.::      |||.:|.|..|.:||||.
 Frog    19 SSILLLIHINGNICMDI------IDGREAASHSRPY-MAYIYSRTGSCGGTLIKQNWVLTAAHCV 76

  Fly    89 AINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALL------F 147
            ..|:.            |:.|:..:...:...|.:.|.|.:.|..:......:||.||      .
 Frog    77 VNNSE------------VILGAHKVKSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAK 129

  Fly   148 LNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWG--KVTMKEKSASLQQAPVPILNKELCQVIYK 210
            ||.|:     .|..:|......:.|::|...|||  |...|..|..|::..|.::::..|..|||
 Frog   130 LNKFV-----SVLKLPTTDMDVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNKIYK 189

  Fly   211 -----LPASQMCAGFLQGG---IDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNV-SH 266
                 :..:.:|||..:..   .|||||||||||||....:||:|:|..|.||.|||:||.: :.
 Frog   190 KFKTEISTNMLCAGAPKKSDKKYDACQGDSGGPLICGKEFSGIVSFGKKCGDPKYPGIYTRLTAR 254

  Fly   267 FLKWIRRANASLD 279
            :|:|||......|
 Frog   255 YLQWIRDVTGGAD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/256 (30%)
Tryp_SPc 38..273 CDD:238113 78/257 (30%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.